PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P21430_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 266aa    MW: 29745.5 Da    PI: 6.9205
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P21430_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1883136356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ eq+++Le+ Fe  +++  e++ +LA  lgL  rqV +WFqNrRa++k
  GSMUA_Achr3P21430_001  83 KKRRLNVEQVRTLEKSFELGNKLEPERKMQLAVALGLRPRQVAIWFQNRRARWK 136
                            4568999**********************************************9 PP

2HD-ZIP_I/II127.94.3e-4182171190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eqv++LE+sFe  +kLeperK++la +Lgl+prqva+WFqnrRAR+ktkqlEkdy++L+r++da+k+ene+L++++++L+
  GSMUA_Achr3P21430_001  82 EKKRRLNVEQVRTLEKSFELGNKLEPERKMQLAVALGLRPRQVAIWFQNRRARWKTKQLEKDYDVLRRQFDAIKAENEALQAHNKKLQ 169
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                            +e
  GSMUA_Achr3P21430_001 170 TE 171
                            65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.58478138IPR001356Homeobox domain
SuperFamilySSF466893.38E-1981140IPR009057Homeodomain-like
SMARTSM003894.8E-1881142IPR001356Homeobox domain
CDDcd000862.66E-1583139No hitNo description
PfamPF000461.4E-1583136IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.3E-1985145IPR009057Homeodomain-like
PRINTSPR000312.0E-5109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000312.0E-5118134IPR000047Helix-turn-helix motif
PfamPF021831.4E-14138178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSCNGMASSF FPSGFMFQLQ APCEDDHQLV SPVRSLIPTN LHHLRGVAPA TGKRSASFSG  60
AETCEEANGD DELSDDASLA GEKKRRLNVE QVRTLEKSFE LGNKLEPERK MQLAVALGLR  120
PRQVAIWFQN RRARWKTKQL EKDYDVLRRQ FDAIKAENEA LQAHNKKLQT EALALRGREA  180
SDLINLNKET EGSCSNRSEN SSEINLDISR TSVAERSSTT SVGRTVEITA AFSSLVELYC  240
NLMFGVQVPD VERRTLEGIN KETRVL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393534.11e-158PREDICTED: homeobox-leucine zipper protein HOX21-like isoform X2
SwissprotQ8LC037e-85ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
SwissprotQ8S7W91e-84HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLM0SGK90.0M0SGK9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P21430_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-86HD-ZIP family protein